Analytical Data
-
Gene name
TrpA
-
简介
The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. TrpA Protein, E.coli is the recombinant E. coli-derived TrpA protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
Tryptophan synthase alpha chain; trpA;
-
Species
E.coli
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A877
-
Expression Region
M1-S268
-
AA Sequence
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS
-
Protein Length
Full Length
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of TrpA recombinant proteins has gained significant attention due to their crucial role in various biological processes and their potential applications in biotechnology and medicine. TrpA, or transient receptor potential cation channel subfamily A, refers to a group of proteins that serve as ion channels, playing essential roles in sensation, thermoregulation, and cellular signaling. These proteins are involved in the detection of environmental stimuli such as temperature and chemical irritants. Research has shown that TrpA channels are implicated in various physiological and pathological conditions, including pain perception, inflammation, and neurodegenerative diseases. Consequently, understanding the structure, function, and regulatory mechanisms of TrpA proteins through recombinant expression systems is vital for elucidating their roles in human health and disease. By producing TrpA proteins in a recombinant form, researchers can study their functional characteristics in vitro, develop specific inhibitors, or design therapeutic agents targeting these channels. Moreover, recombinant TrpA proteins can serve as valuable tools in drug discovery and development, enabling high-throughput screening of compounds that modulate their activity. Overall, the investigation of TrpA recombinant proteins not only enhances our understanding of fundamental biological mechanisms but also paves the way for innovations in therapeutic interventions for conditions associated with TrpA dysregulation.











