Cat: IPD-X33197

Recombinant Human JAK1 Protein (Baculovirus),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    JAK1

  • 简介

    JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    JAK1; JAK-1; JAK1A; JAK1B; Jak1

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P23458

  • Expression Region

    A561-N852

  • AA Sequence

    AQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQN

  • Protein Length

    Partial

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

JAK1, or Janus kinase 1, is a critical signaling protein that plays a pivotal role in various biological processes, including immunity, inflammation, and hematopoiesis. As a part of the Janus kinase family, JAK1 is involved in the signaling pathways of multiple cytokine receptors, facilitating the transduction of signals from extracellular ligands to intracellular responses. Dysregulation of JAK1 is associated with several diseases, including autoimmune disorders, cancers, and cytokine storms, making it a significant target for therapeutic intervention. The study of recombinant JAK1 proteins has gained momentum, allowing researchers to investigate its structure, function, and interaction with various signaling molecules in detail. Recombinant JAK1 proteins are produced through genetic engineering techniques, providing a purified and active form of the protein for various applications, such as drug screening, structural studies, and the development of JAK inhibitors. These inhibitors have shown promise in treating conditions like rheumatoid arthritis and psoriasis by modulating immune responses. Understanding the biochemical properties and regulatory mechanisms of JAK1 through recombinant protein studies is crucial for developing targeted therapies and advancing our knowledge of JAK-STAT signaling pathways in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US