Cat: IPD-X33423

Recombinant Human Maleylacetoacetate isomerase/GSTZ1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Maleylacetoacetate isomerase/GSTZ1

  • 简介

    The maleylacetoacetate isomerase/GSTZ1 protein is a member of the GST superfamily and detoxifies electrophilic molecules. It converts maleylacetoacetate to fumarylacetoacetate, a key step in phenylalanine/tyrosine degradation. Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His) is the recombinant human-derived Maleylacetoacetate isomerase/GSTZ1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuMaleylacetoacetate isomerase/GSTZ1, His; Maleylacetoacetate Isomerase; MAAI; GSTZ1-1; Glutathione S-Transferase Zeta 1; GSTZ1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    NP_665877.1

  • Expression Region

    Q2-A216

  • AA Sequence

    QAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Maleylacetoacetate isomerase (MAAi) is an enzyme that plays a crucial role in the catabolic pathway of tyrosine, facilitating the conversion of maleylacetoacetate into fumarate and acetoacetate. Deficiencies in MAAi can lead to metabolic disorders such as hereditary tyrosinemia, a condition characterized by the accumulation of toxic intermediates that can cause severe liver and kidney damage. The enzyme is encoded by the GSTZ1 gene, which also exhibits glutathione transferase activity, further implicating its importance in detoxification processes. Research on the recombinant protein of Maleylacetoacetate isomerase/GSTZ1 focuses on understanding its structural characteristics, catalytic mechanisms, and functional roles in metabolism. Detailed studies, including crystallography and kinetic analyses, aim to elucidate the interaction of MAAi with substrates and inhibitors, providing insights into potential therapeutic approaches for treating metabolic disorders. The recombinant expression of GSTZ1 facilitates its purification and characterization, enabling researchers to explore its enzymatic properties, stability, and the effects of genetic variations associated with human diseases. This research is essential for developing targeted treatments and understanding the biochemical pathways implicated in tyrosine metabolism, ultimately contributing to better diagnostics and therapeutic strategies for related metabolic disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US