Analytical Data
-
Gene name
PDIA5
-
简介
PDIA5 Protein catalyzes the rearrangement of disulfide bonds in proteins, ensuring proper folding and stabilization. Its vital role maintains protein structure and function, guaranteeing effective performance of designated biological tasks through correct disulfide bond formation. PDIA5 Protein, Human (HEK293, His) is the recombinant human-derived PDIA5 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Protein disulfide-isomerase A5; Protein disulfide isomerase-related protein; PDIA5; PDIR
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14554-2
-
Expression Region
S22-L262
-
AA Sequence
SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPL
-
Protein Length
Partial
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDIA5, or Protein Disulfide Isomerase A5, is a member of the protein disulfide isomerase family, which plays a crucial role in the formation and rearrangement of disulfide bonds in proteins, particularly within the endoplasmic reticulum. This enzyme is essential for proper protein folding, and its dysfunction has been associated with various diseases, including neurodegenerative disorders and cancer. Recent studies have highlighted the importance of PDIA5 in regulating cellular redox status, maintaining protein homeostasis, and influencing cell survival under stress conditions. Furthermore, PDIA5 has been implicated in the immune response, where it may modulate the function of immune cells. The exploration of PDIA5 as a therapeutic target has gained traction, given its potential role in enhancing the efficacy of cancer treatments and improving outcomes in diseases characterized by oxidative stress. Understanding the biochemical properties, structural characteristics, and functional roles of PDIA5 can provide insights into its mechanisms of action and contribute to the development of novel therapeutic strategies aimed at modulating its activity for clinical benefit.
