Analytical Data
-
Gene name
Aldose 1-epimerase/GALM
- Application
-
Alternative Names
rHuAldose 1-epimerase, His; GALM; Aldose 1-epimerase
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96C23
-
Expression Region
A2-A342
-
AA Sequence
ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVAHHHHHH
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
34.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Aldose 1-epimerase, also known as GALM (galactose mutarotase), is an important enzyme involved in the carbohydrate metabolism of sugars, primarily galactose and glucose. This enzyme catalyzes the interconversion between D-galactose and D-glucose by facilitating the epimerization at the C-1 position. A thorough understanding of GALM is crucial due to its role in various biological processes and its implications in metabolic disorders, such as galactosemia, a genetic condition that affects the body's ability to process galactose. Research on recombinant GALM has gained attention in recent years as this enzyme is not only relevant for basic biochemical studies but also has potential biotechnological applications. The production of recombinant GALM allows for detailed structural and functional analyses, which can help elucidate the enzyme's mechanism of action, substrate specificity, and regulation. Additionally, understanding GALM's structure at the molecular level can aid in the design of inhibitors or modulators, which could have therapeutic relevance. As carbohydrate metabolism continues to be an area of intense research, particularly for its implications in health and disease, the study of Aldose 1-epimerase/GALM highlights the intricate connections between enzymatic function, metabolism, and therapeutic potential. Therefore, recombinant GALM serves as a valuable tool for advancing our knowledge of carbohydrate metabolism and developing strategies to combat related metabolic disorders.











