Analytical Data
-
Gene name
RGS5
-
简介
RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G(i)-alpha and G(o)-alpha, it selectively excludes G(s)-alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
Regulator of G-protein signaling 5; RGS5
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15539
-
Expression Region
M1-K181
-
AA Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
-
Protein Length
Full Length
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RGS5 (Regulator of G-protein Signaling 5) is a member of the RGS protein family, which plays a crucial role in regulating G-protein-coupled receptor (GPCR) signaling pathways. Research into RGS5 has gained momentum due to its involvement in several physiological processes, including vascular development, smooth muscle contractility, and angiogenesis. Abnormal expression of RGS5 has been implicated in various pathological conditions, such as hypertension, heart failure, and certain types of cancer, making it a potential therapeutic target. The recombinant expression of RGS5 protein allows for detailed biochemical characterization and functional studies, aiding in the understanding of its role in cell signaling. Additionally, this research has implications for drug development, as modulating RGS5 activity could offer new strategies for treating diseases linked to GPCR dysregulation. By studying the structure and function of RGS5 through recombinant protein techniques, researchers aim to unveil the molecular mechanisms by which RGS5 exerts its effects on cellular signaling, ultimately contributing to advancements in medical therapies and interventions.











