Analytical Data
-
Gene name
TSTA3
-
简介
The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
GDP-L-Fucose Synthase; GDP-4-Keto-6-Deoxy-D-Mannose-3; 5-Epimerase-4-Reductase; Protein FX; Red Cell NADP(H)-Binding Protein; Short-Chain Dehydrogenase/Reductase Family 4E Member 1; TSTA3; SDR4E1
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13630
-
Expression Region
M1-K321
-
AA Sequence
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
-
Protein Length
Full Length
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TSTA3, a member of the tumor-specific transplantation antigen 3 (TSTA3) family, has garnered significant attention due to its potential implications in cancer immunotherapy and vaccine development. Initially identified as a protein expressed in various tumor tissues, TSTA3 plays a crucial role in modulating immune responses. Research has shown that it may serve as a target for T-cell mediated responses, which are pivotal for the destruction of cancer cells. The study of TSTA3 reconstituted proteins aims to elucidate its three-dimensional structure and functional dynamics, enabling scientists to understand its interaction with immune cells better. Additionally, recombinant TSTA3 proteins can be utilized in vaccine formulations to enhance the immune system's recognition of tumors, presenting a promising avenue for novel therapeutic strategies. The investigation into TSTA3's biological activity and its potential as a biomarker for tumor progression further emphasizes its relevance in precision medicine. As researchers continue to explore the mechanisms behind TSTA3, insights gained could be transformative for developing effective treatments for cancer, particularly in harnessing the body's immune defenses to target and eradicate malignant cells more efficiently.
