Cat: IPD-X25816

Recombinant Cynomolgus MICA Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MICA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized Human NKG2D Protein at 5 μg/mL (100 μL/well) can bind Cynomolgus MICA Protein. The ED50 for this effect is 0.3073 μg/mL. Immobilized Human NKG2D Protein at 5 μg/mL (100 μL/well) can bind Cynomolgus MICA Protein . The ED50 for this effect is 0.3073 μg/mL.

  • Alternative Names

    MHC class I polypeptide-related sequence A; MIC-A; PERB11.1

  • Species

    Cynomolgus

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    AAO24115

  • Expression Region

    E1-P288

  • AA Sequence

    ELHSLRYNVTVLSRDGSVQSEFLAEGHLDGQLFVRYDRETRRARPQGQWAEDVLGAKTWDTETGDLTENGKDLRMTLAHIKGQKGGLHSLQEIKVCEIHEDNSTGGLRHFYYDGELFLSQNLETQEWTELQSSRAQTLALNIRNFWKEDTMKTKTHYRAVQADCLKKLQRYLESGVAVRRTAPPMVNVTHSEASEGNITVTCRASGFYPRNIALTWRQDGVSLNHNAQQWGGILPDQNGTYQTWVATRIRQGEEQRFACYMEHSGNHSTHPVPSGKVLVFQSQWLDIP

  • Protein Length

    Partial

  • Molecular Weight

    40-55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MICA, or MHC class I chain-related protein A, is a crucial member of the MHC class I family that plays a significant role in the immune response, particularly in the activation of Natural Killer (NK) cells. Its expression is often upregulated in response to cellular stress, infection, or transformation, marking affected cells for recognition and elimination by the immune system. Research into MICA recombinant proteins has gained momentum due to their potential applications in cancer immunotherapy and transplantation. Understanding the molecular mechanisms governing MICA interactions with NK cell receptors, such as NKG2D, is essential for developing therapeutic strategies that enhance anti-tumor immunity. Furthermore, MICA's polymorphic nature and differential expression patterns in various tissues can impact its effectiveness as a therapeutic target. Studies focusing on the production and characterization of recombinant MICA proteins help elucidate their structural and functional properties, enabling researchers to explore novel ways to modulate immune responses for treating diseases. These investigations not only advance our comprehension of the immune system's complexities but also hold promise for innovative approaches in clinical settings aimed at improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US