Analytical Data
-
Gene name
APCDD1
-
简介
The APCDD1 protein inhibits the Wnt signaling pathway and its mutations are associated with hereditary hypotrichosis simplex, causing hair loss. Increased expression of APCDD1 may be related to colorectal cancer development. The gene is highly expressed in the skin (RPKM 30.0), fat (RPKM 14.2), and 13 other tissues. APCDD1 Protein, Human (HEK293, Fc) is the recombinant human-derived APCDD1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Biological Activity
Immobilized APCDD1 at 1 μg/mL (100 μL/well) can bind Biotinylated Wnt-3a protein. The ED50 for this effect is 148.7 ng/mL. Immobilized APCDD1 at 1 μg/mL (100 μL/well) can bind Biotinylated Wnt-3a protein. The ED50 for this effect is 148.7 ng/mL.
-
Alternative Names
Adenomatosis polyposis coli down-regulated 1 protein; DRAPC1; HYPT1
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8J025
-
Expression Region
L27-G486
-
AA Sequence
LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYG
-
Protein Length
Partial
-
Molecular Weight
85.7 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APCDD1 (Adenomatous Polyposis Coli Down-Regulated 1) is a pivotal protein implicated in various biological processes, including the regulation of Wnt signaling pathways, which are crucial for cellular proliferation, differentiation, and development. The dysregulation of APCDD1 expression has been associated with the pathogenesis of several cancers and other diseases, highlighting its potential as a therapeutic target. Research into APCDD1 recombinant protein focuses on its structural and functional characterization, allowing scientists to elucidate its role in cellular signaling and its interactions with other molecular players in the Wnt pathway. Furthermore, studying recombinant APCDD1 can enhance our understanding of its mechanisms in tumorigenesis and cellular homeostasis, providing insights for developing novel diagnostic and therapeutic strategies. Investigating this protein also contributes to the broader understanding of genetic factors in cancer predisposition and progression. As such, the recombinant production of APCDD1 not only facilitates detailed mechanistic studies but also fosters the exploration of its potential as a biomarker or therapeutic agent, marking an essential step in the fight against cancer and related diseases.
