Cat: IPD-X33620

Recombinant Human MTHFS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MTHFS

  • 简介

    MTHFS proteins play a critical role in tetrahydrofolate metabolism and help regulate carbon flow within the folate-dependent one-carbon metabolic network. This network is critical for providing the carbon units required for purine, thymidine, and amino acid biosynthesis. MTHFS Protein, Human (His) is the recombinant human-derived MTHFS protein, expressed by E. coli , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHu5-formyltetrahydrofolate cyclo-ligase/MTHFS, His; 5-formyltetrahydrofolate cyclo-ligase; 5,10-methenyl-tetrahydrofolate synthetase; MTHFS; Methenyl-THF synthetase

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49914-1

  • Expression Region

    M1-A203

  • AA Sequence

    MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA

  • Protein Length

    Full Length of Isoform-1

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MTHFS (methylenetetrahydrofolate synthetase) is an essential enzyme involved in folate metabolism, specifically in the synthesis of methylenetetrahydrofolate, a crucial cofactor in one-carbon transfer reactions. Folates are vital for DNA synthesis, repair, and methylation, playing a significant role in cellular processes and overall health. Aberrations in folate metabolism can lead to various health issues, including developmental disorders, cardiovascular diseases, and certain cancers. Given its importance, MTHFS has garnered attention in biochemical research, particularly concerning its role in metabolic pathways. The recombinant expression of MTHFS allows for detailed characterization of its enzymatic properties and regulation mechanisms, providing insights into its function in both normal physiology and pathological conditions. Additionally, studying MTHFS at a molecular level can facilitate the development of targeted therapies that manipulate folate metabolism for therapeutic purposes. As a result, research on recombinant MTHFS is vital not only for understanding fundamental biochemical processes but also for exploring potential medical applications in the treatment of diseases related to folate metabolism dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US