Analytical Data
-
Gene name
MTHFS
-
简介
MTHFS proteins play a critical role in tetrahydrofolate metabolism and help regulate carbon flow within the folate-dependent one-carbon metabolic network. This network is critical for providing the carbon units required for purine, thymidine, and amino acid biosynthesis. MTHFS Protein, Human (His) is the recombinant human-derived MTHFS protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
rHu5-formyltetrahydrofolate cyclo-ligase/MTHFS, His; 5-formyltetrahydrofolate cyclo-ligase; 5,10-methenyl-tetrahydrofolate synthetase; MTHFS; Methenyl-THF synthetase
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49914-1
-
Expression Region
M1-A203
-
AA Sequence
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTHFS (methylenetetrahydrofolate synthetase) is an essential enzyme involved in folate metabolism, specifically in the synthesis of methylenetetrahydrofolate, a crucial cofactor in one-carbon transfer reactions. Folates are vital for DNA synthesis, repair, and methylation, playing a significant role in cellular processes and overall health. Aberrations in folate metabolism can lead to various health issues, including developmental disorders, cardiovascular diseases, and certain cancers. Given its importance, MTHFS has garnered attention in biochemical research, particularly concerning its role in metabolic pathways. The recombinant expression of MTHFS allows for detailed characterization of its enzymatic properties and regulation mechanisms, providing insights into its function in both normal physiology and pathological conditions. Additionally, studying MTHFS at a molecular level can facilitate the development of targeted therapies that manipulate folate metabolism for therapeutic purposes. As a result, research on recombinant MTHFS is vital not only for understanding fundamental biochemical processes but also for exploring potential medical applications in the treatment of diseases related to folate metabolism dysfunction.











