Analytical Data
-
Gene name
MESDC2
-
简介
The MESDC2 protein acts as a chaperone and plays a specific role in promoting the folding of the β-propeller/EGF module within the low-density lipoprotein receptor (LDLR) family.In addition to participating in LDLR folding, MESDC2 acts as an important regulator of the Wnt pathway by chaperoning the coreceptors LRP5 and LRP6 to the plasma membrane, thereby affecting Wnt signaling.MESDC2 Protein, Human (HEK293, His) is the recombinant human-derived MESDC2 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 6.109 µg/mL, corresponding to a specific activity is 163.6929 units/mg. Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 6.109 µg/mL, corresponding to a specific activity is 163.6929 units/mg.
-
Alternative Names
LRP chaperone MESD; LDLR chaperone MESD; KIAA0081; MESDM
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q14696-1
-
Expression Region
A34-K230
-
AA Sequence
AEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNK
-
Protein Length
Partial
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MESDC2 (Mesoderm Development Candidate 2) is a member of the MESDC protein family, which has attracted significant attention in recent years due to its role in developmental processes and potential implications in cancer biology. The protein is primarily associated with the Wnt signaling pathway, a crucial regulator of cell proliferation, differentiation, and survival. Abnormalities in this pathway are linked to various malignancies, prompting researchers to investigate the functional mechanisms of MESDC2 in both normal physiological processes and pathological conditions. Studies have suggested that MESDC2 may influence the stability and activity of Wnt receptors, thereby mediating downstream signaling effects. Additionally, its expression patterns and interactions with other cellular components are becoming areas of intense study to understand its role in embryogenesis and tumorigenesis. The exploration of MESDC2 as a potential therapeutic target is gaining traction, as manipulation of its function could offer novel strategies for cancer treatment or regenerative medicine. Thus, the characterization of MESDC2 and its recombinant protein is vital not only for basic biological understanding but also for developing interventions in diseases where Wnt signaling is disrupted.











