Analytical Data
-
Gene name
Cathepsin B
- Application
-
Alternative Names
rMuCathepsin B, His; Cathepsin B; Ctsb; Cathepsin B1
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10605
-
Expression Region
H18-F339
-
AA Sequence
HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFHHHHHH
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
32-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cathepsin B is a cysteine protease that plays a crucial role in various biological processes, including protein degradation, apoptosis, and antigen presentation. It is primarily expressed in lysosomes but also found in other cellular compartments, indicating its multifaceted roles in cellular functions. Research has shown that Cathepsin B is implicated in numerous pathological conditions, including cancer progression, neurodegenerative diseases, and inflammatory disorders. Due to its involvement in these diseases, Cathepsin B is considered a potential therapeutic target, making its study increasingly relevant. The development of recombinant Cathepsin B proteins has enabled detailed investigations into its structure, function, and mechanisms of action. By producing these proteins in a controlled environment, researchers can analyze enzymatic activity, identify substrate specificity, and explore potential inhibitors that may modulate its activity for therapeutic purposes. Additionally, understanding the molecular mechanisms of Cathepsin B can provide insights into its role in disease progression and help in designing targeted therapies. As a result, the recombinant expression and characterization of Cathepsin B have become a vital area of research in biochemistry and pharmacology, with significant implications for drug development and disease treatment strategies.











