Cat: IPD-X26006

Recombinant Rat CHODL Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CHODL

  • 简介

    CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Rat Chondrolectin Protein is immobilized at 1µg/mL (100 µL/well) can bind Recombinant Human IGFBP-5. The ED50 for this effect is 9.923 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat Chondrolectin Protein is immobilized at 1µg/mL (100 µL/well) can bind Recombinant Human IGFBP-5. The ED50 for this effect is 9.923 ng/mL.

  • Alternative Names

    Chondrolectin; Chodl; C21orf68

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    D3ZI86

  • Expression Region

    R22-N216

  • AA Sequence

    RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

  • Protein Length

    Partial

  • Molecular Weight

    30 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CHODL (Chondrocyte-Selective Olfactomedin-Like Protein) is a protein that has garnered attention in the field of molecular biology due to its potential roles in cartilage biology and skeletal development. Originally identified in chondrocytes, CHODL is believed to play a crucial role in the maintenance and regulation of cartilage homeostasis and may contribute to the processes underlying chondrogenesis. Its olfactomedin-like domain suggests involvement in extracellular matrix interactions, which are vital for cartilage integrity and function. Recent studies indicate that alterations in CHODL expression may be linked to various cartilage-related diseases, including osteoarthritis and other degenerative conditions. Understanding the structure and function of CHODL through recombinant protein studies can provide insights into its biological activities and mechanisms of action. Such research holds promise for developing therapeutic strategies aimed at preserving cartilage health and treating related disorders. As scientists continue to explore the molecular pathways associated with CHODL, this protein may emerge as a key target for innovative approaches in regenerative medicine and orthopedic research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US