Analytical Data
-
Gene name
Cathepsin E
- Application
-
Alternative Names
rMuCathepsin E, His; Cathepsin E; ctse;
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P70269
-
Expression Region
S60-P397
-
AA Sequence
SCNVYSSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGEYAVDCATLDTMPNVTFLINEVSYTLNPTDYILPDLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPAVPHHHHHH
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cathepsin E is a papain-like cysteine protease that plays a crucial role in various biological processes, including protein degradation, antigen presentation, and immune response regulation. Unlike other cathepsins, Cathepsin E is predominantly expressed in the immune system, particularly in thymic epithelial cells and antigen-presenting cells, suggesting its significance in T cell development and the modulation of adaptive immunity. The enzyme's involvement in pathological conditions, such as autoimmune diseases and cancer, has generated considerable interest in understanding its biological functions and potential therapeutic applications. Additionally, the recombinant protein production of Cathepsin E has paved the way for detailed structural and functional studies, enabling researchers to investigate its enzymatic mechanisms and interactions with inhibitors. Studies have also indicated that mutations and dysregulation of Cathepsin E may contribute to disease pathology, highlighting the need for continued research into its role and therapeutic potential. As a result, the focus on recombinant Cathepsin E not only aids in deciphering its molecular functions but also represents a promising avenue for the development of targeted therapies in immune-related disorders. The ongoing research into Cathepsin E continues to uncover its complexity and importance in both health and disease, making it an intriguing target for future scientific exploration.











