Analytical Data
-
Gene name
Sortilin/SORT1
-
简介
The Sortilin/SORT1 protein acts as a sorting receptor in the Golgi apparatus and as a clearance receptor on the cell surface. It plays a crucial role in protein transport to lysosomes, independent of M6PR. Sortilin/SORT1 Protein, Human (HEK293, His) is the recombinant human-derived Sortilin/SORT1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Immobilized Recombinant Human Sortilin Protein at 4 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human beta -NGF Protein. The ED50 for this effect is ≤273.8 ng/mL. Immobilized Recombinant Human Sortilin Protein at 4 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human beta -NGF Protein. The ED50 for this effect is 273.8 ng/mL.
-
Alternative Names
Sortilin; SORT1; 100 kDa NT receptor; Glycoprotein 95; Gp95; Gp95LDLCQ6; Neurotensin receptor 3; NT3NTR3; Ntr3; sortilin 1;
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q99523-1
-
Expression Region
S78-N755
-
AA Sequence
SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSN
-
Protein Length
Extracellular Domain
-
Molecular Weight
80-110 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Sortilin, also known as SORT1, is a type I transmembrane protein that belongs to the trafficking receptor family and is implicated in various physiological processes, including neuronal development, lipid metabolism, and the transport of neurotrophic factors. Its role has garnered significant attention due to its involvement in the pathology of several diseases, including Alzheimer's disease and cardiovascular disorders. Importantly, Sortilin has been identified as a receptor for proprotein convertase subtilisin/kexin type 9 (PCSK9), which is crucial for cholesterol homeostasis and LDL receptor degradation. This connection has made SORT1 a prime target for drug development aimed at lowering cholesterol levels and improving cardiovascular health. The characterization and production of recombinant Sortilin/SORT1 protein are essential for understanding its functional mechanisms and interactions at the molecular level. Researchers focus on producing this protein in heterologous systems to facilitate the study of its structure-function relationships and to develop potential therapeutic strategies. Exploring Sortilin's unique properties and biological roles further highlights its importance in clinical research and therapeutic interventions, making it a valuable subject in the fields of cell biology and drug discovery.
