Analytical Data
-
Gene name
Collagen alpha-1(III) chain/COL3A
-
简介
COL3A protein, also known as collagen α-1(III) chain, is an important component of type III collagen and is widely distributed along with type I collagen in most soft connective tissues. In addition to its structural role, COL3A is also involved in the regulation of cortical development. Collagen alpha-1 (III) chain/COL3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collagen alpha-1(III) chain/COL3A protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rMuCollagen alpha-1(III) chain/COL3A, His; Collagen alpha-1(III) chain; Col3a1
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P08121
-
Expression Region
Q155-G1219
-
AA Sequence
QFDSYDVKSGVGGMGGYPGPAGPPGPPGPPGSSGHPGSPGSPGYQGPPGEPGQAGPAGPPGPPGALGPAGPAGKDGESGRPGRPGERGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGAAGERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDGTPGGPGIRGMPGSPGGPGNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGLPGPAGKNGETGPQGPPGPTGPAGDKGDSGPPGPQGLQGIPGTGGPPGENGKPGEPGPKGEVGAPGAPGGKGDSGAPGERGPPGTAGIPGARGGAGPPGPEGGKGPAGPPGPPGASGSPGLQGMPGERGGPGSPGPKGEKGEPGGAGADGVPGKDGPRGPAGPIGPPGPAGQPGDKGEGGSPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGPAGPTGSSGPAGPPGPQGVKGERGSPGGPGTAGFPGGRGLPGPPGNNGNPGPPGPSGAPGKDGPPGPAGNSGSPGNPGIAGPKGDAGQPGEKGPPGAQGPPGSPGPLGIAGLTGARGLAGPPGMPGPRGSPGPQGIKGESGKPGASGHNGERGPPGPQGLPGQPGTAGEPGRDGNPGSDGQPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPSGKSGDRGETGPAGPSGAPGPAGARGAPGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGAAGHQGAIGSPGPAGPRGPVGPHGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGGAAAIAGVGGEKSGGFSPYYG
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
130.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Collagen alpha-1(III) chain, known as COL3A1, is a crucial component of extracellular matrix collagen that plays a significant role in tissue structure and function. It is primarily found in various connective tissues, including skin, blood vessels, and internal organs, where it contributes to their tensile strength and elasticity. Research into COL3A1 has gained prominence due to its association with several pathological conditions, particularly vascular disorders, skin diseases, and genetic syndromes such as Ehlers-Danlos syndrome, which is characterized by hyperelasticity and fragility of tissues. Recombinant COL3A1 protein offers valuable insights into these conditions by providing a model for studying collagen structure-function relationships and their implications in health and disease. The ability to produce recombinant COL3A1 facilitates the investigation of its molecular mechanisms, interactions with other proteins, and potential therapeutic applications, including tissue engineering and regenerative medicine. Moreover, understanding COL3A1's role in collagen synthesis and organization can lead to novel strategies for treating collagen-related diseases, enhancing the quality of life for affected individuals. Thus, research on recombinant COL3A1 is critical for advancing biomedical knowledge and therapeutic approaches related to connective tissue disorders.
