Analytical Data
-
Gene name
AIMP2
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13155
-
Expression Region
M1-K320
-
AA Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK
-
Protein Length
Full Length
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AIMP2 (Aminoacyl-tRNA Synthetase Complex Interacting Multifunctional Protein 2) is a crucial component of the multi-synthetase complex, which plays a vital role in protein synthesis and regulation of cellular functions. This protein is involved in various processes, including amino acid charging of tRNA, signal transduction, and cell growth regulation. Research has shown that AIMP2 is not only essential for normal cellular function but also implicated in several diseases, including cancer, where its expression levels and functional state can influence tumor growth and progression. The significance of AIMP2 in cellular metabolism and its potential as a therapeutic target highlight the need for in-depth studies on its structure, function, and interactions with other proteins. Recent advances in recombinant protein technology have enabled the production of AIMP2 in a purified and functional form, allowing researchers to investigate its biochemical properties and the broader implications of its activity in health and disease. By studying the role of AIMP2 in cellular pathways and its interactions within the multi-synthetase complex, scientists aim to elucidate the mechanistic underpinnings of its involvement in various pathological states, ultimately contributing to the development of novel therapeutic strategies that leverage the modulation of AIMP2 activity in disease contexts.
