Analytical Data
-
Gene name
PDGF R beta
-
简介
PDGF R beta Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers.Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand.The modulation of responses involves heterodimer formation with another receptor, PDGFRB.PDGF R beta Protein, Rat (HEK293, Fc) is the recombinant rat-derived PDGF R beta protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
Platelet-derived growth factor receptor beta; PDGF-R-beta; PDGFR-1; CD140b; PDGFRB
-
Species
Rat
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q05030
-
Expression Region
L32-K530
-
AA Sequence
LVITPPGPEFVLNISSTFVLTCSSSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSSAGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLELSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFK
-
Protein Length
Extracellular Domain
-
Molecular Weight
117 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Platelet-derived growth factor receptor beta (PDGFR-β) is a critical receptor involved in various cellular processes, including cell proliferation, survival, and migration, playing a significant role in development, wound healing, and tissue repair. Aberrant activation of PDGFR-β is implicated in a variety of pathological conditions such as cancer, fibrosis, and cardiovascular diseases. Consequently, understanding PDGFR-β signaling pathways and its interactions with ligands has become a focal point in biomedicine. Recombinant PDGFR-β proteins are utilized in research to elucidate the receptor's structure-function relationships and to develop therapeutic strategies targeting PDGFR-β in diseases. The production of these recombinant proteins, typically through techniques such as recombinant DNA technology and expression systems in bacteria or mammalian cells, allows for detailed studies of the receptor's biochemical properties and biological activities. Insights gained from such research can aid in the design of small-molecule inhibitors or monoclonal antibodies that specifically target PDGFR-β, offering potential treatments for conditions where its dysregulation is a contributing factor. Thus, the study of PDGFR-β recombinant proteins is vital in advancing our understanding of its role in health and disease, and holds promise for the development of innovative therapeutic approaches.
