Cat: IPD-X26788

Recombinant Human JUN Protein,His & Myc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    JUN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized Human JUN Protein at 2 μg/mL (100 μL/well) can bind JUN antibody.The ED50 for this effect is 20-100 ng/mL. Immobilized Human JUN Protein at 2 μg/mL (100 μL/well) can bind JUN antibody.The ED50 for this effect is 24.06 ng/mL.

  • Alternative Names

    Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-10*His;C-Myc

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P05412

  • Expression Region

    M1-F331

  • AA Sequence

    MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

  • Protein Length

    Full Length

  • Molecular Weight

    41-45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Research on JUN recombinant proteins focuses on understanding the role of the JUN proto-oncogene, a vital component of the AP-1 transcription factor complex, which is crucial in regulating gene expression, cell proliferation, differentiation, and apoptosis. The JUN protein, particularly in its phosphorylated form, is implicated in various cellular processes and is associated with numerous pathological conditions, including cancer, inflammation, and tissue repair. Studies often investigate how overexpression or mutation of the JUN gene can lead to oncogenic transformations, making it a significant target for therapeutic intervention. The ability to produce JUN recombinant proteins enables researchers to explore the protein's biochemical properties, interaction with other cellular factors, and its involvement in signaling pathways. By utilizing techniques such as molecular cloning, expression in suitable host systems, and purification processes, scientists can delve into the functions and mechanisms of JUN in greater detail. Furthermore, understanding its dynamics can offer insights into potential drug development aimed at modulating JUN activity for treating diseases where its dysregulation is a contributing factor. As such, examining JUN recombinant proteins is a critical aspect of cancer research and regenerative medicine, providing a foundation for innovations in targeted therapies and biologic treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US