Analytical Data
-
Gene name
YBX1
- Application
-
Alternative Names
YB-1; CCAAT-binding transcription factor I subunit A; CBF-A; DNA-binding protein B; DBPB; Enhancer factor I subunit A; EFI-A; Nuclease-sensitive element-binding protein 1; Y-box transcription factor
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P67809
-
Expression Region
S2-E324
-
AA Sequence
SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YBX1 (Y-box binding protein 1) is a highly conserved nuclear protein that plays a crucial role in various cellular processes, including transcription regulation, RNA processing, and translation. As a key participant in cellular responses to stress, YBX1 has been implicated in cancer biology due to its involvement in tumorigenesis and metastasis. Overexpression of YBX1 is often associated with poor prognosis in cancer patients, making it a potential target for therapeutic interventions. The study of recombinant YBX1 protein has gained significant attention in the field of molecular biology, as it allows researchers to investigate its structural properties, functional mechanisms, and interactions with other biomolecules. Understanding the recombinant expression of YBX1 facilitates the exploration of its role in protein-RNA complexes and post-transcriptional regulation, which may unveil new insights into its contribution to the malignancy of various cancers. Moreover, recombinant YBX1 could serve as a valuable tool in drug discovery and functional assays aimed at elucidating its therapeutic potential. Thus, research involving YBX1 recombinant protein not only enhances our understanding of fundamental biological processes but also paves the way for innovative strategies in cancer treatment.
