Cat: IPD-X12086

Recombinant Human FGF-5 Protein, N-GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FGF-5

  • 简介

    The FGF-5 protein critically regulates cell proliferation and differentiation, particularly during the hair growth cycle. It plays a key role in normal hair follicle progression, inhibiting hair elongation by promoting the anagen to catagen transition. FGF-5 Protein, Human (GST) is the recombinant human-derived FGF-5 protein, expressed by E. coli , with N-GST labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Fibroblast growth factor 5; Heparin-binding growth factor 5; HBGF-5; Smag-82; FGF5

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-GST

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12034-1

  • Expression Region

    A18-G268

  • AA Sequence

    AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fibroblast Growth Factor 5 (FGF-5) is a member of the fibroblast growth factor family, which plays a crucial role in cellular processes such as proliferation, differentiation, and survival. It is particularly known for its involvement in hair follicle cycling, where it regulates hair growth and development. Research indicates that FGF-5 acts as an antagonist to hair follicle elongation, making it a potential target for therapeutic interventions in conditions related to hair loss, such as alopecia. The recombinant production of FGF-5 has garnered significant interest in biotechnology and pharmaceutical research, as it allows for the study of its biological functions and interactions in a controlled environment. Moreover, recombinant FGF-5 could be utilized in regenerative medicine and cosmetic applications, particularly in developing hair growth products. The recombinant version also serves as a valuable tool for pushing forward our understanding of FGF signaling pathways and their implications in various physiological and pathological processes. Investigations into the mechanisms by which FGF-5 influences hair follicle dynamics may pave the way for innovative treatments for hair disorders and contribute to broader applications in tissue engineering and repair. Overall, FGF-5 recombinant protein research represents a fusion of developmental biology, biotechnology, and potential therapeutic advancements, highlighting the importance of this growth factor in both academic and clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US