Cat: IPD-X12107

Recombinant Human; Mouse KGF/FGF-7 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KGF/FGF-7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1.Measured in a cell proliferation assay using BALB/c 3T3 cells and the special bioactivity is <40.58 ng/mL. 2.Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is typically 15-60 ng/mL in the presence of 1 µg/mL heparin. Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is typically 51.21 ng/mL in the presence of 1 µg/mL heparin,corresponding to a specific activity is 1.95×10^4 U/mg.

  • Alternative Names

    Fibroblast growth factor 8; Androgen-induced growth factor; Heparin-binding growth factor 8; AIGF; HBGF-8; FGF-8B

  • Species

    Human;Mouse

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    P55075-3

  • Expression Region

    Q23-R215

  • AA Sequence

    QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

  • Protein Length

    Partial

  • Molecular Weight

    22-28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KGF (keratinocyte growth factor) and FGF-7 (fibroblast growth factor 7) are key members of the FGF family, playing crucial roles in wound healing, hair growth, and epithelial cell proliferation. They primarily function by promoting the survival and proliferation of keratinocytes, which are essential for skin regeneration and repair. Understanding their mechanisms can lead to advancements in regenerative medicine and therapies for skin conditions. Previous studies have highlighted their potential in treating disorders characterized by impaired epithelial repair and have shown promising results in preclinical models. The recombinant production of KGF/FGF-7 allows for the exploration of their therapeutic applications in a more controlled and efficient manner, facilitating investigations into their dosage, efficacy, and safety profiles. Furthermore, the development of these recombinant proteins has implications for clinical settings, including dermatology and plastic surgery, where enhancing wound healing and tissue regeneration is critical. Ongoing research aims to optimize their formulation and delivery methods to maximize their bioactivity and therapeutic outcomes, thereby paving the way for innovative treatments for a variety of skin-related ailments and procedures.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US