Analytical Data
-
Gene name
Coronin-6/CORO6
- Application
-
Alternative Names
rHuCoronin-6/CORO6, His; Coronin-6; Clipin-E; CORO6
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6QEF8-4
-
Expression Region
E255-D472
-
AA Sequence
MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD
-
Protein Length
Partial
-
Molecular Weight
30-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Coronin-6 (CORO6) is a member of the coronin family of proteins, which are known to play crucial roles in the regulation of the cytoskeleton and cell signaling. Initially identified in a variety of organisms, CORO6 has garnered attention due to its involvement in critical cellular processes such as migration, polarization, and immune response regulation. Research has indicated that CORO6 is not only integral to cytoskeletal dynamics but also influences the functionality of immune cells, shaping their behavior during infection and inflammation. Given its significant role in these processes, CORO6 is a potential target for therapeutic interventions in immunological diseases and cancers. The production of recombinant CORO6 protein allows for in-depth studies of its structure-function relationship, enabling researchers to elucidate the molecular mechanisms governing its action in cells. Understanding how CORO6 interacts with other proteins and cellular components may provide insights into its role in various biological contexts and contribute to the development of novel strategies for modulating immune responses and enhancing therapeutic efficacy. As research progresses, CORO6 stands out as a promising candidate for further investigation, both as a biomarker for disease and a potential therapeutic target in the modulation of immune and cytoskeletal responses.
