Analytical Data
-
Gene name
FGF-17
-
简介
The FGF-17 Protein is crucial in regulating embryonic development, functioning as a signaling molecule for inducing and patterning the embryonic brain. It plays an essential role in normal brain development and interacts specifically with FGFR3 and FGFR4 receptors, pivotal in this developmental process. FGF-17 Protein, Mouse (His) is the recombinant mouse-derived FGF-17, expressed by E. coli, with C-6*His labeled tag. The total length of FGF-17 Protein, Mouse (His) is 194 a.a..
- Application
-
Alternative Names
Fibroblast Growth Factor 17; FGF-17; FGF17
-
Species
Mouse
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P63075
-
Expression Region
T23-T216
-
AA Sequence
TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast growth factor 17 (FGF-17) is a member of the fibroblast growth factor family, which plays a pivotal role in various biological processes, including embryonic development, tissue regeneration, and cell differentiation. Research into FGF-17 has gained attention due to its involvement in neurodevelopment and its potential implications in treating neurological disorders and cancers. It is particularly expressed in specific regions of the brain, suggesting its critical role in neurogenesis and neural repair. Additionally, FGF-17 has been linked to the regulation of signaling pathways essential for maintaining the integrity of neural tissues. The recombinant expression of FGF-17 provides a valuable tool for investigating its functional properties and molecular mechanisms. By producing this protein in a controlled environment, researchers can explore its physiological roles and therapeutic potential, particularly in regenerative medicine. Studies have shown that FGF-17 can promote neuronal survival and enhance synaptic plasticity, making it a candidate for innovative therapeutic strategies in neurodegenerative diseases. Overall, understanding the complexities of FGF-17 through recombinant protein research can facilitate the development of novel interventions aimed at harnessing its biological activities for clinical applications.











