Analytical Data
-
Gene name
FGFR-1
-
简介
FGFR-1 alpha, a conserved member of the FGFR family, binds acidic and basic fibroblast growth factors, influencing mitogenesis and differentiation. Mutations in FGFR1 cause syndromes and disorders. It exhibits ubiquitous expression, with notable levels in ovary (RPKM 21.8), fat (RPKM 21.4), and 25 other tissues. Alternatively spliced variants contribute to its functional diversity. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived FGFR-1 alpha, expressed by HEK293 , with C-His, C-10*His labeled tag. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His), has molecular weight of 60-90 kDa.
- Application
-
Biological Activity
Measured by its ability to inhibit FGF acidic-dependent proliferation of NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 4.134 ng/mL, corresponding to a specific activity is 2.42×10^5 units/mg. Measured by its ability to inhibit FGF acidic-dependent proliferation of NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 4.134 ng/mL, corresponding to a specific activity is 2.42×105 units/mg.
-
Alternative Names
Fibroblast growth factor receptor 2; FGFR-2; FGF R2a; FGFR2 alpha
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11362-7
-
Expression Region
P11362-7/NP_056934.2 (R22-K310&A359-E374)&AAB19502 (H1-P47)
-
AA Sequence
A1: RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK A2: ALEERPAVMTSPLYLE A3: HSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSAWLTVTRP
-
Protein Length
Partial
-
Molecular Weight
60-90 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast growth factor receptor 1 (FGFR-1) is a crucial receptor that plays vital roles in various biological processes, including cellular proliferation, differentiation, and survival. Research on FGFR-1 has gained momentum due to its significant implications in developmental biology and pathophysiology, particularly in cancer. Abnormal FGFR-1 signaling has been linked to various malignancies, including breast, lung, and bladder cancers, making it a target for therapeutic intervention. The development of recombinant FGFR-1 proteins has been instrumental in elucidating its structural and functional properties. By generating these proteins through recombinant DNA technology, researchers can produce pure and functional FGFR-1 to study its interactions with ligands, downstream signaling pathways, and the effects of mutations associated with cancer. Additionally, understanding the molecular mechanisms governing FGFR-1 activity can aid in the design of FGFR-targeted therapies, such as selective inhibitors and antibodies, offering potential treatment strategies for FGFR-1-driven tumors. The advancement of FGFR-1 recombinant protein studies has also provided insights into the receptor's role in tissue regeneration and repair, highlighting its importance beyond oncology. As research continues to uncover the complexities of FGFR-1 signaling, it remains a key focus in both basic and translational research aimed at improving disease outcomes through targeted molecular therapies.











