Analytical Data
-
Gene name
ELA1
- Application
-
Alternative Names
ELA1；ELA1；Chymotrypsin-like elastase family member 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09093
-
Expression Region
29-270aa
-
AA Sequence
VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
-
Molecular Weight
42.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ELA1 is a recombinant protein that has garnered significant attention in recent years due to its potential applications in biomedicine and biotechnology. Originating from the ELA gene, which is involved in various physiological processes, ELA1 has been studied for its role in immune response modulation and its potential therapeutic benefits. Researchers have been exploring the protein's structure and functionality to better understand its mechanisms of action and its interactions with other biomolecules. The ability to produce ELA1 through recombinant DNA technology allows for large-scale production and purification, facilitating in-depth studies and potential clinical applications. Recent advancements in protein engineering techniques have enabled modifications to enhance its stability, activity, and specificity. Additionally, the growing interest in personalized medicine has spurred investigations into ELA1's role in disease mechanisms, particularly in conditions such as cancer and autoimmune disorders. Through preclinical studies, scientists are evaluating the efficacy of ELA1 as a therapeutic agent or as a diagnostic tool. The understanding of ELA1’s biological functions may lead to novel interventions that harness its therapeutic properties, making it a focal point of contemporary research in protein science and therapeutic development. Overall, the study of ELA1 not only sheds light on its biological significance but also opens avenues for innovative solutions in treating various health challenges.
