Analytical Data
-
Gene name
ACOT13
- Application
-
Alternative Names
ACOT13；THEM2；Acyl-coenzyme A thioesterase 13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPJ3
-
Expression Region
1-140aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMTSMTQSLREVIKAMTKARNFERVLGKITL VSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCTERGAP GVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIA QGRHTKHLGN
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACOT13 (Acyl-CoA thioesterase 13) is part of a larger family of enzymes known as acyl-CoA thioesterases, which play a key role in lipid metabolism by hydrolyzing acyl-CoA esters to free fatty acids and coenzyme A. The regulation of acyl-CoA levels is critical for various cellular processes, including energy production, signaling, and membrane composition. Recent studies have indicated that ACOT13 is involved in cellular responses to different nutrient states, suggesting its potential role in metabolic diseases such as obesity and diabetes. Furthermore, ACOT13 may influence the balance of lipids within the cell, impacting inflammation and the development of metabolic syndrome. Understanding the structure and function of ACOT13 through recombinant protein studies provides insights into its enzymatic activity, regulatory mechanisms, and potential as a therapeutic target. The characterization of ACOT13 can elucidate its specific functions in various tissues and contribute to the overall understanding of lipid homeostasis and related disorders. As research continues, ACOT13 may emerge as a significant player in metabolic regulation, making it a compelling focus for further biochemical and pharmaceutical studies aimed at addressing metabolic diseases.
