Analytical Data
-
Gene name
PP
- Application
-
Alternative Names
PP;PPP1A;Serine/threonine-Protein phosphatase PP1-alpha catalytic subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60510
-
Expression Region
1-308aa
-
AA Sequence
MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVT VCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLAL KVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYL SLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDP EDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFN ETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK PVADYFL
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on PP (protein-protein) recombinant proteins has gained significant attention due to their essential roles in various biological processes and their potential applications in biotechnology and medicine. PP interactions are fundamental to cellular functions, influencing pathways such as signal transduction, metabolic regulation, and immune responses. Advances in molecular biology techniques, particularly in genetic engineering and recombinant DNA technology, have enabled the production of these proteins in controlled environments, facilitating in-depth studies of their structure and function. The ability to express and purify PP recombinant proteins allows researchers to investigate their interactions and mechanisms at a molecular level, leading to insights into disease mechanisms, including cancer, neurodegenerative diseases, and infectious diseases. Furthermore, these proteins hold promise in therapeutic applications, such as the development of targeted drugs and vaccines. The growing demand for precision medicine and biologics has propelled research in this field forward, driving innovations in protein design and engineering. By utilizing techniques such as site-directed mutagenesis, protein crystallography, and mass spectrometry, scientists aim to dissect the complex networks of PP interactions and harness their potential for therapeutic interventions. Overall, the study of PP recombinant proteins represents a convergence of fundamental research and practical applications, paving the way for novel approaches in disease treatment and understanding of cellular dynamics.











