Cat: PA1000-8912

Recombinant Human PP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PP;PPP1A;Serine/threonine-Protein phosphatase PP1-alpha catalytic subunit

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P60510

  • Expression Region

    1-308aa

  • AA Sequence

    MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVT VCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLAL KVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYL SLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDP EDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFN ETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK PVADYFL

  • Molecular Weight

    60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on PP (protein-protein) recombinant proteins has gained significant attention due to their essential roles in various biological processes and their potential applications in biotechnology and medicine. PP interactions are fundamental to cellular functions, influencing pathways such as signal transduction, metabolic regulation, and immune responses. Advances in molecular biology techniques, particularly in genetic engineering and recombinant DNA technology, have enabled the production of these proteins in controlled environments, facilitating in-depth studies of their structure and function. The ability to express and purify PP recombinant proteins allows researchers to investigate their interactions and mechanisms at a molecular level, leading to insights into disease mechanisms, including cancer, neurodegenerative diseases, and infectious diseases. Furthermore, these proteins hold promise in therapeutic applications, such as the development of targeted drugs and vaccines. The growing demand for precision medicine and biologics has propelled research in this field forward, driving innovations in protein design and engineering. By utilizing techniques such as site-directed mutagenesis, protein crystallography, and mass spectrometry, scientists aim to dissect the complex networks of PP interactions and harness their potential for therapeutic interventions. Overall, the study of PP recombinant proteins represents a convergence of fundamental research and practical applications, paving the way for novel approaches in disease treatment and understanding of cellular dynamics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US