Cat: PA1000-8938

Recombinant Human PTP4A3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PTP4A3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TP;PRL3;Protein tyrosine phosphatase type IVA 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75365

  • Expression Region

    1-173aa

  • AA Sequence

    MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM

  • Molecular Weight

    19.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PTP4A3, also known as protein tyrosine phosphatase 4A3, is a member of the PTP family, which plays a crucial role in regulating various cellular processes through dephosphorylation of tyrosine residues on target proteins. Its expression has been linked to several types of cancer, particularly in the context of cell proliferation, migration, and invasion. Overexpression of PTP4A3 has been associated with tumorigenesis and poor prognosis in various malignancies, making it a potential oncogenic factor. Researchers have focused on understanding the functional mechanisms of PTP4A3 in signaling pathways involved in cancer progression, including its interactions with other cellular proteins and its role in modifying the tumor microenvironment. The study of recombinant PTP4A3 proteins allows for the investigation of its enzymatic activity, regulatory mechanisms, and potential as a therapeutic target. By producing PTP4A3 in a controlled laboratory setting, scientists can conduct detailed biochemical assays and structural studies, paving the way for the development of inhibitors that specifically target PTP4A3's phosphatase activity. This research is critical for unlocking new avenues for cancer treatment and enhancing our understanding of the molecular underpinnings of oncogenesis. As such, PTP4A3 has emerged as an important focus in the field of cancer research, driving efforts to elucidate its role in tumor biology and therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US