Cat: PA1000-131DB

Recombinant Human ALDOB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ALDOB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ALDOB;ALDB;Fructose-bisphosphate aldolase B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06975

  • Expression Region

    1-364aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMAHRFPALTQEQKKELSEIAQSIVAN GKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGG VILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQ GLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYAS ICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEG TLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMS EEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQE AFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Aldose reductase (ALDO) is a key enzyme in the polyol pathway that converts glucose into sorbitol, playing a critical role in various physiological and pathological processes, including diabetic complications, cataract formation, and neuropathy. Research on ALDO has gained significant attention due to its involvement in oxidative stress and the development of diabetic microvascular complications. Dysregulation of this enzyme has been linked to increased sorbitol accumulation, leading to osmotic and oxidative damage in cells, particularly in the retina, kidneys, and nervous system. The therapeutic potential of targeting ALDO has prompted extensive studies to characterize its structure and function, particularly through recombinant protein methods. By expressing ALDO in various systems, researchers aim to elucidate its enzymatic activity, substrate specificity, and interaction with inhibitors, which may pave the way for the development of novel therapeutic agents to combat conditions associated with ALDO overactivity. Additionally, understanding the protein's structure could provide insights into its regulatory mechanisms, enhancing our knowledge of its role in health and disease. Overall, ALDO recombinant protein studies are crucial for designing targeted therapies and improving patient outcomes in diabetes and other metabolic disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US