Analytical Data
-
Gene name
AMTN
- Application
-
Alternative Names
AMTN；Amelotin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UX39
-
Expression Region
17-209aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSLPQLKPALGLPPTKLAPDQGTLPNQQQ SNQVFPSLSLIPLTQMLTLGPDLHLLNPAAGMTPGTQTHPLTLGGLNVQQ QLHPHVLPIFVTQLGAQGTILSSEELPQIFTSLIIHSLFPGGILPTSQAG ANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDDDFAVTTPAGIQRS THAIEEATTESANGIQ
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AMTN (Amelotin) is an intriguing protein that has garnered significant attention in recent years due to its potential roles in enamel development and dental health. Initially identified as a member of the odontogenic proteins, AMTN is thought to play a crucial role in the mineralization process of dental enamel by regulating the formation and stability of enamel matrix. Research indicates that AMTN is predominantly expressed in the enamel organ during tooth development, suggesting its importance in the early stages of enamel formation. Deficiencies or mutations in AMTN may contribute to various dental disorders, including enamel hypoplasia, which is characterized by insufficiencies in enamel thickness and quality. Furthermore, studies are beginning to explore the protein's involvement in dental remineralization processes, which could have therapeutic implications for caries management and preventive dentistry. As the understanding of AMTN's functions and mechanisms advances, it opens new avenues for investigating its potential applications in regenerative dentistry, as well as in the development of biomimetic materials that could enhance dental restoration techniques. The ongoing research into AMTN is not only pivotal for elucidating the molecular underpinnings of tooth development and maintenance but also for developing innovative treatments aimed at improving oral health outcomes.
