Analytical Data
-
Gene name
TAS2R38
- Application
-
Alternative Names
TAS2R38；PTC；Taste receptor type 2 member 38
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P59533
-
Expression Region
1-333aa
-
AA Sequence
MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCL SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSK LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNT RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLE AHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISG NAKLRRAVMTILLWAQSSLKVRADHKADSRTLC
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAS2R38 is a member of the TAS2R family of bitter taste receptors, which play a crucial role in the perception of bitterness in various plant compounds and are linked to dietary preferences and nutritional choices. Variations in the TAS2R38 gene result in differential sensitivity to bitter compounds, leading to phenotypic differences in taste perception among individuals. This gene exhibits polymorphisms, particularly in populations of European descent, leading to distinct taste phenotypes: the "supertasters," who are highly sensitive to bitter flavors, and "non-tasters," who have a reduced ability to perceive bitterness. The study of TAS2R38 recombinant proteins is significant for understanding the molecular mechanisms behind bitter taste sensitivity and has implications for fields like nutrition, genetics, and public health. By expressing and characterizing TAS2R38 in a recombinant system, researchers can investigate the receptor's functional properties, ligand interactions, and signaling pathways. This research not only sheds light on basic taste biology but also informs strategies for developing food products that cater to different taste preferences, potentially influencing dietary habits and health outcomes. Understanding TAS2R38's role in taste perception may also contribute to insights on how genetic differences affect food choices and susceptibility to taste-related health conditions, highlighting the interplay between genetics and dietary behaviors.
