Analytical Data
-
Gene name
WNT10B
- Application
-
Alternative Names
WNT10B；WNT12；Protein Wnt-10b
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His-Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00744
-
Expression Region
30-322aa
-
AA Sequence
EILGLKLPGEPPLTANTVCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHEC QHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACS LGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQ DTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKR KCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRL RPRRLSGELVYFEKSPDFCERDP
-
Molecular Weight
36.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
WNT10B is a member of the WNT signaling pathway, which plays a crucial role in various developmental processes, including cell proliferation, differentiation, and tissue homeostasis. The significance of WNT10B has gained attention due to its involvement in regulating stem cell maintenance and its potential implications in various diseases, including cancer and metabolic disorders. Recent studies have indicated that WNT10B may influence adipogenesis and bone development, suggesting its role in obesity and osteoporosis. Given its critical functions, the demand for WNT10B recombinant protein has increased for both research and therapeutic purposes. Producing high-quality recombinant WNT10B enables scientists to investigate its biological activities and interactions at a molecular level, contributing to a better understanding of its function in various cellular contexts. Furthermore, recombinant WNT10B is being explored for its potential utility in regenerative medicine, tissue engineering, and as a therapeutic target in metabolic and degenerative diseases. Advancements in protein expression systems and purification techniques are essential for developing effective experimental tools, paving the way for discovering novel therapeutic approaches that can manipulate WNT signaling pathways for clinical benefits. Overall, the research on WNT10B recombinant protein is poised to unlock new insights into its biological roles and therapeutic potential, marking an important step forward in the field of molecular biology and regenerative medicine.
