Cat: PA1000-371DB

Recombinant Human BST2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BST2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BST2;Bone marrow stromal antigen 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q10589

  • Expression Region

    40-180aa

  • AA Sequence

    PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAA TCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRR ENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BST2, also known as tetherin or CD317, is a type II transmembrane protein that plays a critical role in the innate immune response against viral infections. It was first identified as an interferon-inducible gene and has since been recognized for its ability to inhibit the release of newly formed virions from infected cells, effectively trapping them on the cell surface. This property is particularly important in the context of HIV-1 and other enveloped viruses, as BST2 can restrict their propagation. The protein exerts its effects through its unique mechanism of tethering viral particles to the cell membrane, thereby preventing their budding and subsequent spread. However, many viruses have evolved mechanisms to counteract BST2, demonstrating the ongoing arms race between viral pathogens and the host immune system. Research into BST2 has been expanding rapidly, exploring its potential as a therapeutic target for enhancing antiviral responses and understanding its regulatory role in various physiological and pathological processes, including cancer progression and immune regulation. The study of BST2 has also uncovered its broader implications in cell signaling and interactions with other cellular proteins. Hence, the characterization and functional analysis of BST2 reconcile its significance not only in virology but also in immunology and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US