Analytical Data
-
Gene name
BST2
- Application
-
Alternative Names
BST2；Bone marrow stromal antigen 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q10589
-
Expression Region
40-180aa
-
AA Sequence
PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAA TCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRR ENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BST2, also known as tetherin or CD317, is a type II transmembrane protein that plays a critical role in the innate immune response against viral infections. It was first identified as an interferon-inducible gene and has since been recognized for its ability to inhibit the release of newly formed virions from infected cells, effectively trapping them on the cell surface. This property is particularly important in the context of HIV-1 and other enveloped viruses, as BST2 can restrict their propagation. The protein exerts its effects through its unique mechanism of tethering viral particles to the cell membrane, thereby preventing their budding and subsequent spread. However, many viruses have evolved mechanisms to counteract BST2, demonstrating the ongoing arms race between viral pathogens and the host immune system. Research into BST2 has been expanding rapidly, exploring its potential as a therapeutic target for enhancing antiviral responses and understanding its regulatory role in various physiological and pathological processes, including cancer progression and immune regulation. The study of BST2 has also uncovered its broader implications in cell signaling and interactions with other cellular proteins. Hence, the characterization and functional analysis of BST2 reconcile its significance not only in virology but also in immunology and therapeutic development.
