Analytical Data
-
Gene name
FBLN2
- Application
-
Alternative Names
FBLN2;Fibulin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P98095
-
Expression Region
1076-1184aa
-
AA Sequence
FLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGDTIALNIIKGN EEGYFGTRRLNAYTGVVYLQRAVLEPRDFALDVEMKLWRQGSVTTFLAKM HIFFTTFAL
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBLN2, or fibulin-2, is a member of the fibulin family of extracellular matrix proteins that play crucial roles in tissue structure, repair, and cellular processes. Research interest in FBLN2 has grown due to its involvement in various pathological conditions, including cancer, cardiovascular diseases, and fibrotic disorders. The protein is known to bind to several matrix components and growth factors, modulating cellular behavior and influencing the microenvironment. Its expression has been linked to tumor progression and metastasis, making it a potential biomarker and therapeutic target. Recent studies utilizing recombinant FBLN2 proteins have aimed to elucidate its biochemical properties and functional roles in cell adhesion, migration, and differentiation. By examining the effects of FBLN2 in both normal and diseased tissues, researchers hope to better understand its contribution to disease mechanisms and identify strategies for intervention. Additionally, the development of recombinant FBLN2 for experimental applications has opened avenues for investigating its potential in regenerative medicine and tissue engineering, highlighting the protein's relevance in both basic and applied biomedical research.











