Analytical Data
-
Gene name
CISD1
- Application
-
Alternative Names
CISD1；C10orf70；ZCD1；CDGSH iron-sulfur domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZ45
-
Expression Region
32-108aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSKRFYVKDHRNKAMINLHIQKDNPKIVH AFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CISD1, also known as CDGSH iron sulfur domain 1, is a protein that plays a vital role in cellular functions, particularly in mitochondrial biology and iron-sulfur cluster assembly. Recent research has highlighted its significance in maintaining mitochondrial homeostasis, regulating oxidative stress, and its involvement in various cellular signaling pathways. Studies have demonstrated that CISD1 contributes to the preservation of mitochondrial integrity and function, suggesting its potential role in neurodegenerative diseases and aging processes. The aberrant functioning of CISD1 has been associated with disorders such as Alzheimer's disease and other neurodegenerative conditions, where oxidative stress and mitochondrial dysfunction are key pathological features. The recombinant expression of CISD1 in various model systems is essential for elucidating its biological roles and mechanisms of action. By producing and analyzing CISD1 through recombinant techniques, researchers aim to investigate its structure-function relationships, identify potential interaction partners, and explore its therapeutic potential. Understanding the comprehensive role of CISD1 in cellular metabolism and mitochondrial health could pave the way for developing novel interventions for diseases linked to mitochondrial dysfunction and oxidative stress. Thus, CISD1 remains a focal point for biochemistry research, providing insights into the molecular underpinnings of cellular health and disease.
