Cat: PA1000-626DB

Recombinant Human CISD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CISD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CISD1;C10orf70;ZCD1;CDGSH iron-sulfur domain-containing Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NZ45

  • Expression Region

    32-108aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSKRFYVKDHRNKAMINLHIQKDNPKIVH AFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

  • Molecular Weight

    11 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CISD1, also known as CDGSH iron sulfur domain 1, is a protein that plays a vital role in cellular functions, particularly in mitochondrial biology and iron-sulfur cluster assembly. Recent research has highlighted its significance in maintaining mitochondrial homeostasis, regulating oxidative stress, and its involvement in various cellular signaling pathways. Studies have demonstrated that CISD1 contributes to the preservation of mitochondrial integrity and function, suggesting its potential role in neurodegenerative diseases and aging processes. The aberrant functioning of CISD1 has been associated with disorders such as Alzheimer's disease and other neurodegenerative conditions, where oxidative stress and mitochondrial dysfunction are key pathological features. The recombinant expression of CISD1 in various model systems is essential for elucidating its biological roles and mechanisms of action. By producing and analyzing CISD1 through recombinant techniques, researchers aim to investigate its structure-function relationships, identify potential interaction partners, and explore its therapeutic potential. Understanding the comprehensive role of CISD1 in cellular metabolism and mitochondrial health could pave the way for developing novel interventions for diseases linked to mitochondrial dysfunction and oxidative stress. Thus, CISD1 remains a focal point for biochemistry research, providing insights into the molecular underpinnings of cellular health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US