Analytical Data
-
Gene name
CIRBP
- Application
-
Alternative Names
CIRBP；A18HNRNP；CIRP；Cold-inducible RNA-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14011
-
Expression Region
1-172aa
-
AA Sequence
MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG FVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGG RGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGG YSDRSSGGSYRDSYDSYATHNE
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CIRBP (Cold-Inducible RNA-Binding Protein) has garnered attention in recent years due to its critical role in cellular responses to stress, particularly in low-temperature conditions. As a highly conserved protein, CIRBP is involved in the regulation of gene expression and the stability of mRNA, impacting cellular functions such as differentiation, proliferation, and apoptosis. In various studies, CIRBP has been implicated in several physiological and pathological processes, including cancer progression, neuroprotection, and cellular survival during stress. Its ability to bind RNA and modulate the translation of specific mRNAs allows CIRBP to orchestrate a complex network of stress-response genes. Furthermore, the protein's expression levels are known to fluctuate under different environmental conditions, making it a key player in the adaptation of cells to stress. Understanding CIRBP’s mechanisms of action can provide valuable insights into its potential as a therapeutic target in diseases associated with cellular stress responses, such as cancer and neurodegenerative disorders. The recombinant expression of CIRBP allows researchers to further investigate its structure-function relationships, interactions with nucleic acids, and overall role in cellular stress management, paving the way for novel intervention strategies in related diseases.
