Analytical Data
-
Gene name
CLEC5A
- Application
-
Alternative Names
CLEC5A；CLECSF5；MDL1；C-type lectin domain family 5 member A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NY25
-
Expression Region
28-188aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSPQIFNKSNDGFTTTRSYGTVSQIFGSS SPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGS TLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTN QNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLEC5A, also known as C-type lectin domain family 5 member A, is a receptor expressed primarily on immune cells, such as macrophages and dendritic cells. It plays a significant role in the recognition of pathogens and the modulation of immune responses. Research has shown that CLEC5A is involved in the pathogenesis of various diseases, including viral infections, such as dengue fever and Ebola, as well as autoimmune disorders. The protein is thought to function as a pattern recognition receptor, recognizing glycoproteins on the surface of pathogens and triggering inflammatory pathways. Given its pivotal role in immune regulation, CLEC5A has emerged as a potential therapeutic target for modulating immune responses in various pathological conditions. Recent studies have focused on the structural characterization of CLEC5A, including its interactions with ligands and downstream signaling pathways. Understanding the function and mechanisms of CLEC5A may provide insights into novel therapeutic interventions for infectious diseases and immune-related disorders. Researchers are exploring recombinant CLEC5A proteins to study its properties, which could enhance our knowledge of its role in immunology and lead to new strategies for treatment and prevention.
