Analytical Data
-
Gene name
CLMP
- Application
-
Alternative Names
CLMP;ACAM;ASAM;CXADR-like membrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H6B4
-
Expression Region
19-233aa
-
AA Sequence
THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSS RHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGR YVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQR IREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKES CVVRVTVQYVQSIGMVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLMP (Carcinoembryonic Antigen-related Cell Adhesion Molecule 1) is a member of the CEACAM family, known for its role in cell adhesion and communication. Recent studies have indicated that CLMP plays a critical role in various biological processes, including embryonic development, immune responses, and tumor progression. The understanding of CLMP's function has gained particular interest due to its potential implications in cancer biology, where altered expression of cell adhesion molecules can influence tumor metastasis and immune evasion. As a result, researchers have focused on the recombinant production of CLMP to facilitate in-depth studies of its structural and functional properties. Recombination techniques allow for the generation of highly pure and active CLMP, enabling scientists to investigate its molecular interactions and pathways in detail. The ability to produce CLMP in a controlled laboratory environment paves the way for potential therapeutic applications and the development of novel cancer diagnostics. Furthermore, studying CLMP's role in cell signaling may provide insights into how tumors utilize adhesion mechanisms to spread, ultimately aiding in the discovery of new strategies for cancer treatment. Overall, the research into CLMP and its recombination is pivotal for advancing our understanding of cell adhesion dynamics and their impact on health and disease.











