Analytical Data
-
Gene name
SGPL1
- Application
-
Alternative Names
SGPL1；KIAA1252；Sphingosine-1-phosphate lyase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95470
-
Expression Region
1-568aa
-
AA Sequence
MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH
-
Molecular Weight
63.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SGPL1 (sphingosine-1-phosphate lyase 1) is an important enzyme involved in sphingolipid metabolism, specifically in the irreversible degradation of sphingosine-1-phosphate (S1P), a signaling molecule that plays critical roles in various biological processes, including cell proliferation, survival, and migration. Dysregulation of S1P levels has been implicated in several diseases, including cancer, cardiovascular disorders, and inflammatory conditions. Researchers have shown that SGPL1 is a key regulator of S1P signaling, and its activity influences numerous physiological responses. The recombinant expression of SGPL1 has emerged as a crucial tool for studying its enzymatic properties, understanding its role in pathological conditions, and exploring potential therapeutic applications. By producing SGPL1 in a controlled environment, scientists are able to investigate the enzyme's structure-function relationships, identify inhibitors that modulate its activity, and assess its potential as a drug target. The study of recombinant SGPL1 is also significant for developing diagnostic biomarkers for diseases associated with altered sphingolipid metabolism. Overall, SGPL1 research is critical for unveiling the complexities of sphingolipid signaling and its implications in health and disease, paving the way for novel therapeutic strategies.
