Analytical Data
-
Gene name
CNTFR
- Application
-
Alternative Names
CNTFR;Ciliary neurotrophic factor receptor subunit alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26992
-
Expression Region
23-346aa
-
AA Sequence
QRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLNGS QLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYP KGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLF STIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRL EVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYA GKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTST TSSLAPPPTTKICDPGELGSGGGP
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNTFR, or ciliary neurotrophic factor receptor, plays a crucial role in the nervous system by mediating the effects of ciliary neurotrophic factor (CNTF), a neurotrophic factor involved in neuronal survival, differentiation, and repair. Research on CNTFR has gained significance due to its potential therapeutic implications for neurodegenerative diseases, where promoting neuronal survival and function is critical. CNTFR is a member of the glycoprotein family and exists as a receptor that interacts with CNTF to activate intracellular signaling pathways. Studies have shown that CNTFR is expressed in various neural tissues, emphasizing its importance in supporting motor neuron function and maintaining neuronal health. The generation of recombinant CNTFR proteins has facilitated detailed investigations into its structure, function, and interaction with CNTF, paving the way for potential clinical applications. By understanding the signaling mechanisms mediated by CNTFR, researchers aim to explore innovative treatment strategies for disorders such as amyotrophic lateral sclerosis (ALS) and spinal muscular atrophy (SMA). Furthermore, the elucidation of CNTFR's role in neuroprotection and neuronal regeneration can provide insights into designing drugs that mimic or enhance its activity, offering new hopes for patients suffering from debilitating neurological conditions. The ongoing research aims not only to dissect the complexities of CNTFR signaling but also to explore its potential in regenerative medicine and neurotherapeutics, making CNTFR a significant focus in the field of neurobiology.
