Analytical Data
-
Gene name
CNRIP1
- Application
-
Alternative Names
CNRIP1；C2orf32;CB1 cannabinoid receptor-interacting Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96F85
-
Expression Region
1-164aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMGDLPGLVRLSIALRIQPNDGPVFYKV DGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKE PDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYN YHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNRIP1, or Calcium/Calmodulin-dependent Protein Kinase 1-Interacting Protein 1, has emerged as a significant focus of research due to its crucial role in cellular calcium signaling and its implications in various physiological and pathological conditions. Studies have shown that CNRIP1 interacts with calcium-dependent proteins, thereby influencing multiple signaling pathways that regulate cell growth, differentiation, and apoptosis. Its expression levels have been linked to numerous diseases, including cancer and neurological disorders, raising interest in understanding its functional mechanisms. The production and study of recombinant CNRIP1 protein offer valuable insights into its structure-function relationship and biological activity. Through techniques such as genetic engineering and protein expression systems, researchers can generate large quantities of CNRIP1 for biochemical assays, structural analysis, and potential therapeutic applications. This research not only aims to elucidate the molecular interactions of CNRIP1 but also to explore its potential as a biomarker or therapeutic target, thus contributing to the advancement of disease treatment strategies and understanding of calcium signaling pathways in human health.
