Analytical Data
-
Gene name
MRPS16
- Application
-
Alternative Names
MRPS16；RPMS16；Small ribosomal subunit Protein bS16m
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3D3
-
Expression Region
1-137aa
-
AA Sequence
VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
-
Molecular Weight
38.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPS16, a mitochondrial ribosomal protein, plays a crucial role in protein synthesis within the mitochondria, essential for cellular energy production. Its involvement in mitochondrial function has drawn attention due to the significant role mitochondria play in various biological processes and diseases, including neurodegeneration and metabolic disorders. Recent studies have highlighted that mutations in MRPS16 are linked to distinct mitochondrial dysfunctions, further emphasizing its importance in human health. Researchers are particularly interested in understanding the structural and functional properties of MRPS16 to elucidate its mechanism of action in mitochondrial ribosome assembly and its contribution to mitochondrial protein synthesis. The investigation of MRPS16 as a recombinant protein not only facilitates the study of its biochemical properties but also aids in exploring potential therapeutic strategies for mitochondrial diseases. By generating and characterizing MRPS16 recombinant protein, scientists aim to uncover its role in mitochondrial pathology and its possible implications in developing targeted treatments for conditions associated with mitochondrial dysfunction. The ongoing research into MRPS16 reflects a growing recognition of the critical role of mitochondrial proteins in health and disease, paving the way for advancements in molecular medicine and therapeutic interventions.
