Cat: PA1000-751DB

Recombinant Human CST6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CST6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CST6;Cystatin-M

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15828

  • Expression Region

    29-149aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMRPQERMVGELRDLSPDDPQVQKAAQAAVA SYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDH VDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM

  • Molecular Weight

    16 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CST6, or Cystatin E/M, is a member of the cystatin superfamily of cysteine protease inhibitors that plays a critical role in various physiological processes, including the regulation of extracellular proteolytic activity and the modulation of inflammation. Dysregulation of CST6 has been implicated in several pathological conditions, such as tumor progression, cardiovascular diseases, and neurodegenerative disorders. Recent studies have highlighted the importance of CST6 in maintaining tissue homeostasis and its potential as a biomarker for early diagnosis and prognosis of certain cancers. Additionally, CST6 is involved in the immune response, influencing both innate and adaptive immunity. The recombinant protein form of CST6 allows for the detailed study of its structure-function relationship, cellular interactions, and mechanistic pathways. Understanding the molecular basis of CST6 can facilitate the development of targeted therapies and novel diagnostic tools. As research on CST6 continues to expand, it underscores the significance of this protein in molecular biology and its potential therapeutic applications in human diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US