Analytical Data
-
Gene name
NDUFA2
- Application
-
Alternative Names
NDUFA2；NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43678
-
Expression Region
1-99aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAAAAASRGVGAKLGLREIRIHLCQRS PGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNV PLNNFSADQVTRALENVLSGKA
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDUFA2, or NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2, is a crucial component of the mitochondrial NADH:ubiquinone oxidoreductase complex, commonly known as Complex I. This multi-subunit enzyme plays a vital role in the electron transport chain, facilitating the transfer of electrons derived from NADH to ubiquinone, thereby contributing to ATP production through oxidative phosphorylation. Mutations or dysfunctions in NDUFA2 have been implicated in various mitochondrial diseases, leading to deficits in cellular energy metabolism, oxidative stress, and neurodegenerative disorders. Research on NDUFA2 recombinant proteins aims to elucidate its structural and functional properties, providing insights into the molecular mechanisms underlying Complex I assembly and activity. Through approaches such as X-ray crystallography, cryo-electron microscopy, and enzyme activity assays, scientists are working to understand how alterations in NDUFA2 affect mitochondrial function and overall cellular health. This research not only enhances our comprehension of mitochondrial biology but also opens avenues for therapeutic strategies targeting mitochondrial dysfunction, which is increasingly linked to a variety of metabolic and age-related diseases. Furthermore, studying NDUFA2 can contribute to developing diagnostic tools for mitochondrial disorders, enabling early detection and intervention, thereby improving patient outcomes.
