Analytical Data
-
Gene name
DCAF7
- Application
-
Alternative Names
DCAF7；HAN11；WDR68;DDB1- and CUL4-associated factor 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61962
-
Expression Region
19-295aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMVYAMNWSVRPDKRFRLALGSFVEEYNNKV QLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRV WRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTI WGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGA DGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEV VILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWD
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCAF7, or DDB1 and CUL4-associated factor 7, is a protein that plays a significant role in various cellular processes, including the regulation of the cell cycle, DNA damage response, and protein degradation via the ubiquitin-proteasome system. The study of DCAF7 has gained attention due to its involvement in oncogenesis, where dysregulation may contribute to cancer development and progression. Research has indicated that DCAF7 acts as an adapter protein that links specific substrates to the CUL4-DDB1 E3 ubiquitin ligase complex, thereby facilitating ubiquitination and subsequent proteasomal degradation. This process is crucial for maintaining cellular homeostasis and regulating the levels of key regulatory proteins. The recombinant expression of DCAF7 allows for in-depth studies into its structural and functional properties, as well as its interaction with various substrates. Understanding the molecular mechanisms by which DCAF7 contributes to cellular functions, particularly in the context of tumors, could provide insights into potential therapeutic targets for cancer treatment. Moreover, the ability to produce DCAF7 as a recombinant protein opens avenues for high-throughput screening of small molecules that could modulate its activity. Overall, the ongoing research into DCAF7 and its recombinant protein applications is essential for elucidating its role in health and disease, and for exploring its potential as a biomarker or therapeutic target in oncology.
