Analytical Data
-
Gene name
DDR2
- Application
-
Alternative Names
DDR2；NTRKR3；TKT；TYRO10;Discoidin domain-containing receptor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16832
-
Expression Region
467-855aa
-
AA Sequence
SNSTYDRIFPLRPDYQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPE GVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPRKLLTFK EKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANK NARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMIMEYMENGDLNQFL SRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNC LVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTT ASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQ PAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLLLQQGDE
-
Molecular Weight
70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDR2 (Discoidin Domain Receptor 2) is a type of receptor tyrosine kinase that plays a critical role in the regulation of various cellular processes, including cell adhesion, migration, and proliferation, particularly in response to the extracellular matrix (ECM). Its involvement in fibrotic diseases and cancer progression has garnered significant research interest, as DDR2 can modulate the behavior of fibroblasts and other cell types within the tumor microenvironment. The receptor is activated by collagen, which initiates intracellular signaling pathways that contribute to tissue remodeling and repair. Given its essential functions and the pathological implications of its dysregulation, the study of DDR2 and the development of recombinant proteins or inhibitors targeting DDR2 could provide valuable insights into therapeutic strategies for fibrotic diseases and certain cancers. By utilizing recombinant DNA technology, researchers can produce DDR2 proteins in a controlled manner, facilitating the exploration of its structural and functional properties. This research background highlights the potential of DDR2 as a target for drug development, emphasizing the need for detailed studies on its mechanisms of action and the roles it plays in health and disease. Understanding DDR2's interaction with ECM components and its downstream signaling pathways could lead to novel interventions aimed at mitigating diseases characterized by excessive fibrosis or tumor progression. As the field evolves, the investigation of DDR2 as both a biomarker and a therapeutic target will be crucial in advancing our knowledge of ECM biology and improving clinical outcomes for patients affected by related conditions.
