Cat: IPD-X10169

Recombinant Human IL-4RA Protein (HEK293), C-mFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-4RA

  • 简介

    IL-4R alpha is a subunit alpha shared by IL-4 and IL-13 receptors, found in leukocytes originally. IL-4R alpha couples to the JAK1/2/3-STAT6 pathway and involves in promoting Th2 differentiation[1]. IL-4R alpha/CD124, Human consists of 825 amino acids (M1-S825) with a transmembrane domain (233-256 a.a) and a soluble form (1-227 a.a). Soluble IL-4R (sIL-4R) inhibits IL4-mediated cell proliferation and IL-5 up-regulation by T-cells[1]. IL-4R alpha/CD124, Human (M26-Q231) is produced in HEK293 cells with a C-Terminal mFc-tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 6.904 ng/mL, corresponding to a specific activity is 1.448×105 units/mg, in the presence 2 ng/mL of Recombinant Human IL-4. Measured by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 6.904 ng/mL, corresponding to a specific activity is 1.448×105 units/mg, in the presence 2 ng/mL of Recombinant Human IL-4.

  • Alternative Names

    rHuInterleukin-4 receptor subunit alpha/IL-4 RA, mFc; Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD124; IL-4-binding protein; IL4-BP; IL4R; IL4RA

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-mFc

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.

  • Uniprot

    P24394

  • Expression Region

    M26-Q231

  • AA Sequence

    MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    65-90 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-4 receptor alpha (IL-4RA) is a key component of the immune response, primarily mediating the effects of interleukin-4 (IL-4) and interleukin-13 (IL-13), two critical cytokines involved in allergic reactions, asthma, and various immune disorders. The IL-4RA receptor is involved in the differentiation and proliferation of immune cells, particularly T-helper 2 (Th2) cells, which are pivotal in driving allergic inflammation. Dysregulation of IL-4RA signaling has been implicated in the pathogenesis of several diseases, including asthma, atopic dermatitis, and chronic rhinosinusitis. Understanding the structure and function of IL-4RA is crucial for the development of targeted therapies aimed at modulating immune responses. Researchers are exploring recombinant IL-4RA proteins to elucidate the receptor's biological pathways, assess its potential as a therapeutic target, and improve our understanding of Th2-mediated conditions. These studies may pave the way for innovative treatment strategies that could mitigate the impact of IL-4RA-related diseases, providing hope for more effective management of allergic conditions through the modulation of IL-4 signaling pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US