Cat: PA2000-3631

Recombinant E.coli rpsM Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    rpsM

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rpsM;Small ribosomal subunit Protein uS13

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0A7S9

  • Expression Region

    2-118aa

  • AA Sequence

    ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK

  • Molecular Weight

    40.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RpsM, or ribosomal protein S13, is a pivotal component of the ribosomal machinery in bacteria, playing a critical role in protein synthesis. As one of the key ribosomal proteins, RpsM is involved in stabilizing the structure of the ribosome and facilitating interactions between ribosomal RNA and messenger RNA. Research into the recombinant form of RpsM has gained traction due to its potential implications in understanding ribosomal function and its interactions with antibiotics, which can target bacterial protein synthesis. Given the rising concern of antibiotic resistance among pathogenic bacteria, studying RpsM not only aids in elucidating the fundamental mechanisms of ribosome assembly and function but also provides a pathway for novel therapeutic strategies. Furthermore, recombinant RpsM can be used in structural studies, enabling the determination of ribosomal complexes and their dynamics, thus contributing to a deeper understanding of the translation process. Advances in biotechnology and genetic engineering have facilitated the production of recombinant RpsM, allowing researchers to investigate its biochemical properties and role in ribosomal biogenesis. Overall, research on RpsM offers significant insights into fundamental biological processes and holds promise for innovative approaches in combating bacterial infections.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US