Cat: PA1000-896DB

Recombinant Human DNAJB8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DNAJB8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DNAJB8;DnaJ homolog subfamily B member 8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NHS0

  • Expression Region

    1-232aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMANYYEVLGVQASASPEDIKKAYRKLALRW HPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGCDSWRAGGGAS TPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFNSDRGGRGHGL RGAFSAGFGEFPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFK SVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTVNGKEQLKWMD SK

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DNAJB8, a member of the DNAJ (Hsp40) protein family, has garnered significant attention in the context of cellular stress responses and protein homeostasis. This co-chaperone plays a pivotal role in modulating the activity of Hsp70, enhancing the protein folding process crucial for maintaining cellular functions under stress conditions, such as heat shock or oxidative stress. Moreover, DNAJB8 has been implicated in various pathological conditions, including neurodegenerative diseases and cancer, where protein misfolding and aggregation are prevalent. Its involvement in these diseases highlights its potential as a therapeutic target. Recent studies have focused on the characterization of DNAJB8 recombinant proteins to better understand its structure-function relationship and to explore its role in cellular mechanisms. Understanding the biochemical properties of DNAJB8, including its interaction with other chaperones and substrates, could provide insights into its potential applications in therapeutic strategies aimed at ameliorating protein misfolding disorders. Additionally, the development of DNAJB8 recombinant proteins enhances the ability to produce high-yield, functional proteins for various research applications, including drug development and biomarker discovery. Overall, the study of DNAJB8 recombinant proteins represents a promising avenue for advancing our comprehension of molecular chaperones in health and disease.


E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US